Recombinant Rat MAP4K1 Protein, C-His tagged
Cat.No. : | MAP4K1-05R |
Product Overview : | Recombinant Rat MAP4K1 Protein with C-His tag was expressed in Insect cells. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Description : | Predicted to enable ATP binding activity and MAP kinase kinase kinase kinase activity. Predicted to be involved in several processes, including JNK cascade; cellular response to phorbol 13-acetate 12-myristate; and protein phosphorylation. Used to study transient cerebral ischemia. Orthologous to human MAP4K1 (mitogen-activated protein kinase kinase kinase kinase 1). |
Source : | Insect cells |
Species : | Rat |
Tag : | His |
Molecular Mass : | The protein has a calculated MW of 34.1 kDa. |
AA Sequence : | GSATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAYDLLQRLGGGTYGEVFKARDKVSKDLVALKMVKMEPDDDVSTLQKEILMLKSCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDSGEVKLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSSSFHNFVKVTLTKNSKKRPSATKMLSHQLVHHHHHH |
Purity : | > 70% by SDS-PAGE |
Storage : | Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.05 mg/mL |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | Map4k1 mitogen activated protein kinase kinase kinase kinase 1 [ Rattus norvegicus ] |
Official Symbol | MAP4K1 |
Synonyms | MAP4K1; mitogen activated protein kinase kinase kinase kinase 1; mitogen-activated protein kinase kinase kinase kinase 1; |
Gene ID | 292763 |
mRNA Refseq | NM_001106243 |
Protein Refseq | NP_001099713 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MAP4K1 Products
Required fields are marked with *
My Review for All MAP4K1 Products
Required fields are marked with *
0
Inquiry Basket