Recombinant Monkey MAP4K1 Protein, C-His tagged

• Cat.No.: MAP4K1-03M
• Product Overview: Recombinant Monkey MAP4K1 Protein with C-His tag was expressed in Insect cells.

Specification

• Description: Enables ATP binding activity and MAP kinase kinase kinase kinase activity. Involved in several processes, including JNK cascade; cellular response to phorbol 13-acetate 12-myristate; and protein phosphorylation. Located in membrane.
• Source: Insect cells
• Species: Monkey
• Tag: His
• Molecular Mass: The protein has a calculated MW of 34.49 kDa.
• AA Sequence: GSATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAPRDHYDLLQRLGGGTYGEVFKARDKASGDLVALKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILVNDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVHHHHHH
• Purity: > 60% by SDS-PAGE
• Storage: Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.2 mg/mL
• Storage Buffer: PBS, pH 7.4

Gene Information

• Gene Name: MAP4K1 mitogen-activated protein kinase kinase kinase kinase 1 [ Macaca mulatta ]
• Official Symbol: MAP4K1
• Synonyms: MAP4K1; mitogen-activated protein kinase kinase kinase kinase 1
• Gene ID: 694259
• mRNA Refseq: XM_028840014
• Protein Refseq: XP_028695847
• UniProt ID: A0A1D5R952