Recombinant Newcastle Disease Virus HN Protein (115-473 aa), His-Myc-tagged

• Cat.No.: HN-2230N
• Product Overview: Recombinant Newcastle Disease Virus (strain Her/33) (NDV) HN Protein (115-473 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.

Specification

• Species: NDV
• Source: Yeast
• Tag: His&Myc
• Protein Length: 115-473 aa
• Description: Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusionNeuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 42.7 kDa
• AA Sequence: NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: HN hemagglutinin-neuraminidase [ Avian avulavirus 1 ]
• Official Symbol: HN
• Synonyms: HN
• Gene ID: 37627205
• UniProt ID: P35741