Recombinant Full Length Simian Virus 5 Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL13018PF |
Product Overview : | Recombinant Full Length Simian virus 5 Hemagglutinin-neuraminidase(HN) Protein (P04850) (1-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Parainfluenza virus 5 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-565) |
Form : | Lyophilized powder |
AA Sequence : | MVAEDAPVRATCRVLFRTTTLIFLCTLLALSISILYESLITQKQIMSQAGSTGSNSGLGS ITDLLNNILSVANQIIYNSAVALPLQLDTLESTLLTAIKSLQTSDKLEQNCSWSAALIND NRYINGINQFYFSIAEGRNLTLGPLLNMPSFIPTATTPEGCTRIPSFSLTKTHWCYTHNV ILNGCQDHVSSNQFVSMGIIEPTSAGFPFFRTLKTLYLSDGVNRKSCSISTVPGGCMMYC FVSTQPERDDYFSAAPPEQRIIIMYYNDTIVERIINPPGVLDVWATLNPGTGSGVYYLGW VLFPIYGGVIKGTSLWNNQANKYFIPQMVAALCSQNQATQVQNAKSSYYSSWFGNRMIQS GILACPLRQDLTNECLVLPFSNDQVLMGAEGRLYMYGDSVYYYQRSNSWWPMTMLYKVTI TFTNGQPSAISAQNVPTQQVPRPGTGDCSATNRCPGFCLTGVYADAWLLTNPSSTSTFGS EATFTGSYLNTATQRINPTMYIANNTQIISSQQFGSSGQEAAYGHTTCFRDTGSVMVYCI YIIELSSSLLGQFQIVPFIRQVTLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P04850 |
◆ Recombinant Proteins | ||
TPSB2-418H | Recombinant Human TPSB2 Protein, His-tagged | +Inquiry |
YURS-4005B | Recombinant Bacillus subtilis YURS protein, His-tagged | +Inquiry |
CLIC2-734R | Recombinant Rhesus Macaque CLIC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX11B-8923Z | Recombinant Zebrafish SOX11B | +Inquiry |
DDL-3603S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 DDL protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-01C | Native Human COVID-19 Convalescent Plasma IgG | +Inquiry |
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
HPX-206H | Native Human Native Human HPX | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF148-141HCL | Recombinant Human ZNF148 293 Cell Lysate | +Inquiry |
CSNK1G1-662HCL | Recombinant Human CSNK1G1 cell lysate | +Inquiry |
RFXANK-2394HCL | Recombinant Human RFXANK 293 Cell Lysate | +Inquiry |
APOO-8774HCL | Recombinant Human APOO 293 Cell Lysate | +Inquiry |
Muscles-863R | Mini Rabbit S. Muscles Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket