Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL2115NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (P35740) (1-571aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-571) |
Form : | Lyophilized powder |
AA Sequence : | MDRAVNRVVLENEEREAKNTWRLVFRIAVLLLMVMTLAISAAALVYSMGASTPRDLAGIS TVISKTEDKVTSLLSSKQDVIDRIYKQVALESPLALLNTESIIMNAITSLSYQINGAANN SGCGEPVHDPDYIGGIGKELIVDDISDVTSFYPSAYQEHLNFIPAPTTGSGCTRIPSFDM STTHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDTQNRKSCSV SATPLGCDMLCSKVTETEEEDYKSVTPTSMVHGRLGFDGQYHEKDLDTTVLFKDWVANYP GVGGGSFIDDRVWFPVYGGLKPNSPSDTAQEGKYVIYKRYNNTCPDEQDYQIRMAKSSYK PGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTITLMGAEGRVLTVGTSHFLYQRGSSY FSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCITGVYTDPYPLIFHR NHTLRGVFGTMLDDEQARLNPVSAVFDNISRSRVTRVSSSSTKAAYTTSTCFKVVKTNKA YCLSIAEISNTLFGEFRIVPLLVEILKDDRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P35740 |
◆ Recombinant Proteins | ||
RFL35281SF | Recombinant Full Length Sorghum Bicolor Casp-Like Protein Sb05G021340 (Sb05G021340) Protein, His-Tagged | +Inquiry |
SOAT1-2868H | Recombinant Human SOAT1, GST-tagged | +Inquiry |
EGFR-337H | Active Recombinant Human EGFRvIII Protein (Leu 25 - Ser 645), His-tagged | +Inquiry |
KCNMB1-272H | Recombinant Human KCNMB1, GST-tagged | +Inquiry |
Nup88-5799M | Recombinant Mouse Nup88 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
IgG-339H | Native Horse IgG | +Inquiry |
Fgb -68R | Native Rat Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ileum-444S | Sheep Ileum Lysate, Total Protein | +Inquiry |
MITD1-4307HCL | Recombinant Human MITD1 293 Cell Lysate | +Inquiry |
COPZ2-7350HCL | Recombinant Human COPZ2 293 Cell Lysate | +Inquiry |
Stomach-776C | Chicken Stomach Membrane Lysate, Total Protein | +Inquiry |
GSTT2-5708HCL | Recombinant Human GSTT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket