Recombinant Mycobacterium Tuberculosis ADK Protein (1-181 aa), His-SUMO-tagged

• Cat.No.: ADK-2233M
• Product Overview: Recombinant Mycobacterium Tuberculosis (strain ATCC 25177/H37Ra) ADK Protein (1-181aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Mycobacterium Tuberculosis
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-181 aa
• Description: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 36.1 kDa
• AA Sequence: MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: adk
• UniProt ID: A5U0B9