Recombinant Escherichia coli ADK Protein (1-214 aa), His-tagged
Cat.No. : | ADK-1290E |
Product Overview : | Recombinant Escherichia coli (strain K12) ADK Protein (1-214 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-214 aa |
Description : | Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.6 kDa |
AA Sequence : | MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | adk adenylate kinase [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | ADK |
Synonyms | dnaW; ECK0468; plsA; |
Gene ID | 945097 |
Protein Refseq | NP_415007.1 |
UniProt ID | P69441 |
◆ Recombinant Proteins | ||
ADK-904S | Recombinant Streptomyces coelicolor A3(2) ADK protein, His-tagged | +Inquiry |
ADK-1364M | Recombinant Mouse ADK Protein | +Inquiry |
ADK-26098TH | Recombinant Human ADK, His-tagged | +Inquiry |
ADK-185R | Recombinant Rat ADK Protein, His (Fc)-Avi-tagged | +Inquiry |
Adk-3158M | Recombinant Mouse Adk, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADK-505HCL | Recombinant Human ADK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADK Products
Required fields are marked with *
My Review for All ADK Products
Required fields are marked with *
0
Inquiry Basket