Recombinant Mouse VRK1 Protein (1-440 aa), His-Myc-tagged
Cat.No. : | VRK1-2305M |
Product Overview : | Recombinant Mouse VRK1 Protein (1-440 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-440 aa |
Description : | Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 55.2 kDa |
AA Sequence : | MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGLEQDMLRLDRRGSRTRKKAQK |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Vrk1 vaccinia related kinase 1 [ Mus musculus ] |
Official Symbol | VRK1 |
Synonyms | VRK1; vaccinia related kinase 1; vaccinia-related kinase 1; 51PK; |
Gene ID | 22367 |
mRNA Refseq | NM_001029843 |
Protein Refseq | NP_001025014 |
UniProt ID | Q80X41 |
◆ Recombinant Proteins | ||
VRK1-322H | Recombinant Human VRK1 Protein, His & GST-tagged | +Inquiry |
VRK1-112H | Recombinant Human VRK1 protein, His-tagged | +Inquiry |
VRK1-2305M | Recombinant Mouse VRK1 Protein (1-440 aa), His-Myc-tagged | +Inquiry |
VRK1-5176R | Recombinant Rhesus monkey VRK1 Protein, His-tagged | +Inquiry |
VRK1-9822HF | Active Recombinant Full Length Human VRK1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VRK1-001HCL | Recombinant Human VRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VRK1 Products
Required fields are marked with *
My Review for All VRK1 Products
Required fields are marked with *
0
Inquiry Basket