Recombinant Mouse Ttr Protein

• Cat.No.: Ttr-1392M
• Product Overview: Recombinant Mouse Ttr Protein (23-147aa) was expressed in E. coli with N-terminal His tag.

Specification

• Source: E. coli
• Species: Mouse
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 13.5 kDa
• AA Sequence: AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVE
  LDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Tag: Non
• Protein length: 23-147 a.a.

Gene Information

• Gene Name: Ttr transthyretin [ Mus musculus (house mouse) ]
• Official Symbol: Ttr
• Synonyms: D17860; AA408768; AI787086; prealbumin
• Gene ID: 22139
• mRNA Refseq: NM_013697.5
• Protein Refseq: NP_038725.1
• UniProt ID: P07309