Recombinant Cynomolgus monkey TTR protein, His-tagged
Cat.No. : | TTR-3633C |
Product Overview : | Recombinant Cynomolgus monkey TTR protein(Q8HXW1)(21-147aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-147aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.7 kDa |
AA Sequence : | GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
TTR-1220HFL | Recombinant Full Length Human TTR Protein, C-Flag-tagged | +Inquiry |
TTR-31111TH | Recombinant Human TTR | +Inquiry |
Ttr-729M | Recombinant Mouse Ttr protein, His-tagged | +Inquiry |
TTR-129H | Recombinant Human TTR Protein, His-tagged | +Inquiry |
TTR-730P | Recombinant Pig TTR protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTR Products
Required fields are marked with *
My Review for All TTR Products
Required fields are marked with *
0
Inquiry Basket