Recombinant Mouse Trem2 protein, His-tagged

• Cat.No.: Trem2-3621M
• Product Overview: Recombinant Mouse Trem2 protein(Q99NH8)(19-171aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 19-171aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.8 kDa
• AA Sequence: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Trem2 triggering receptor expressed on myeloid cells 2 [ Mus musculus ]
• Official Symbol: Trem2
• Synonyms: TREM2; triggering receptor expressed on myeloid cells 2; TREM-2; triggering receptor expressed on monocytes 2; triggering receptor expressed on myeloid cells 2a; triggering receptor expressed on myeloid cells 2b; triggering receptor expressed on myeloid cells 2c; Trem2a; Trem2b; Trem2c
• Gene ID: 83433
• mRNA Refseq: NM_031254
• Protein Refseq: NP_112544