Recombinant Mouse Trem2 protein, His-tagged
Cat.No. : | Trem2-3621M |
Product Overview : | Recombinant Mouse Trem2 protein(Q99NH8)(19-171aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-171aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Trem2 triggering receptor expressed on myeloid cells 2 [ Mus musculus ] |
Official Symbol | Trem2 |
Synonyms | TREM2; triggering receptor expressed on myeloid cells 2; TREM-2; triggering receptor expressed on monocytes 2; triggering receptor expressed on myeloid cells 2a; triggering receptor expressed on myeloid cells 2b; triggering receptor expressed on myeloid cells 2c; Trem2a; Trem2b; Trem2c; |
Gene ID | 83433 |
mRNA Refseq | NM_031254 |
Protein Refseq | NP_112544 |
◆ Recombinant Proteins | ||
Trem2-312M | Active Recombinant Mouse Trem2 protein, Fc-tagged | +Inquiry |
TREM2-1933H | Recombinant Human TREM2 Protein (19-174 aa), His-tagged | +Inquiry |
Trem2-3621M | Recombinant Mouse Trem2 protein, His-tagged | +Inquiry |
Trem2-3276M | Recombinant Mouse Trem2, His-tagged | +Inquiry |
TREM2-04H | Recombinant Human TREM2 Protein (19-174aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREM2-2186MCL | Recombinant Mouse TREM2 cell lysate | +Inquiry |
TREM2-2649HCL | Recombinant Human TREM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Trem2 Products
Required fields are marked with *
My Review for All Trem2 Products
Required fields are marked with *
0
Inquiry Basket