Recombinant Human TREM2 Protein (19-174aa), C-His-tagged

• Cat.No.: TREM2-04H
• Product Overview: Recombinant human TREM2 (19-174aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 19-174aa
• Description: This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.
• Form: Liquid
• Molecular Mass: 18.2 kDa (162aa)
• AA Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Notes: Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens (human) ]
• Official Symbol: TREM2
• Synonyms: TREM2; triggering receptor expressed on myeloid cells 2; PLOSL2; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on myeloid cells 2; triggering receptor expressed on monocytes 2; triggering receptor expressed on myeloid cells 2a
• Gene ID: 54209
• mRNA Refseq: NM_018965
• Protein Refseq: NP_061838
• MIM: 605086
• UniProt ID: Q9NZC2