Recombinant Human TREM2 Protein (19-174 aa), His-tagged
Cat.No. : | TREM2-1933H |
Product Overview : | Recombinant Human TREM2 Protein (19-174 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-174 aa |
Description : | May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.4 kDa |
AA Sequence : | HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens ] |
Official Symbol | TREM2 |
Synonyms | TREM2; TREM 2; Trem2a; Trem2b; Trem2c; TREM-2; |
Gene ID | 54209 |
mRNA Refseq | NM_018965 |
Protein Refseq | NP_061838 |
MIM | 605086 |
UniProt ID | Q9NZC2 |
◆ Recombinant Proteins | ||
TREM2-313C | Active Recombinant Cynomolgus TREM2 protein, His-tagged | +Inquiry |
TREM2-3301C | Recombinant Chicken TREM2 | +Inquiry |
Trem2-9578M | Recombinant Mouse Trem2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TREM2-5927H | Recombinant Human TREM2 Protein (His19-Arg161), N-His tagged | +Inquiry |
Trem2-6616M | Recombinant Mouse Trem2 Protein (Lys19-Thr227), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREM2-2649HCL | Recombinant Human TREM2 cell lysate | +Inquiry |
TREM2-2186MCL | Recombinant Mouse TREM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TREM2 Products
Required fields are marked with *
My Review for All TREM2 Products
Required fields are marked with *
0
Inquiry Basket