Recombinant Mouse Sting1 Full Length Transmembrane protein, His-tagged
Cat.No. : | Sting1-267M |
Product Overview : | Recombinant Mouse Sting1 protein(Q3TBT3)(1-378aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-378aa |
Form : | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
AA Sequence : | MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLL KNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMF GLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRM FNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYS NSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILED VPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEP RLLISGMDQPLPLRTDLI |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
STING1-136H | Recombinant Human STING1 M284 variant Protein, His-tagged | +Inquiry |
STING1-14H | Recombinant Human STING1 Protein (H232 variant), His-tagged | +Inquiry |
STING1-148H | Recombinant Human STING1 R232, G230A, R293Q mutant Protein, His-tagged | +Inquiry |
STING1-2122H | Recombinant Human STING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sting1-267M | Recombinant Mouse Sting1 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
STING-016H | Recombinant Human STING Protein, His&GST tagged | +Inquiry |
STING-03H | Active Recombinant TMEM173 (STING) Protein, His tagged | +Inquiry |
STING-04H | Recombinant Human STING M284 variant Protein | +Inquiry |
STING-01H | Active Recombinant Human STING Protein, His tagged | +Inquiry |
STING-015HFL | Recombinant Full Length Human STING Protein, Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sting1 Products
Required fields are marked with *
My Review for All Sting1 Products
Required fields are marked with *
0
Inquiry Basket