Recombinant Human STING1 Protein (H232 variant), His-tagged

• Cat.No.: STING1-14H
• Product Overview: Recombinant STING corresponding to amino acids 139-379 of human STING H232 allele (UniProtKB-Q86WV6) was expressed in E. coli cells and contains a His tag at the N-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Leu139-Ser379
• Description: This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. The encoded protein has also been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants.
• AA Sequence: MGHHHHHHHHGSLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
• Purity: > 90% as analyzed by SDS-PAGE
• Notes: This product is for laboratory research use only.
• Storage: The product can be stored at -20 centigrade or below. Avoid repeated freezing and thawing cycles.
• Storage Buffer: 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, 10% glycerol, 2 mM DTT, 0.1% Tween 20

Gene Information

• Gene Name: STING1 stimulator of interferon response cGAMP interactor 1 [ Homo sapiens (human) ]
• Official Symbol: STING1
• Synonyms: STING1; stimulator of interferon response cGAMP interactor 1; ERIS; MITA; MPYS; SAVI; NET23; STING; hMITA; hSTING; TMEM173; STING-beta; stimulator of interferon genes protein; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; mitochondrial mediator of IRF3 activation; stimulator of interferon protein; transmembrane protein 173
• Gene ID: 340061
• mRNA Refseq: NM_198282
• Protein Refseq: NP_938023
• MIM: 612374
• UniProt ID: D6RID9