Recombinant Mouse Pparg protein, His-tagged
Cat.No. : | Pparg-3362M |
Product Overview : | Recombinant Mouse Pparg protein(P37238)(1-505aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-505aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 63.3 kDa |
AA Sequence : | MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Pparg peroxisome proliferator activated receptor gamma [ Mus musculus ] |
Official Symbol | Pparg |
Synonyms | PPARG; peroxisome proliferator activated receptor gamma; peroxisome proliferator-activated receptor gamma; nuclear receptor subfamily 1 group C member 3; peroxisome proliferator activated receptor gamma 2; peroxisome proliferator activated receptor gamma 4; Nr1c3; PPARgamma; PPAR-gamma; PPARgamma2; PPAR-gamma2; |
Gene ID | 19016 |
mRNA Refseq | NM_001127330 |
Protein Refseq | NP_001120802 |
◆ Recombinant Proteins | ||
PPARG-13162M | Recombinant Mouse PPARG Protein | +Inquiry |
PPARG-68H | Recombinant Human PPARG, 1-477aa, His-tagged | +Inquiry |
PPARG-33HFL | Active Recombinant Full Length human PPARG protein, His tagged | +Inquiry |
PPARG-4253R | Recombinant Rat PPARG Protein, His (Fc)-Avi-tagged | +Inquiry |
PPARG-28671TH | Recombinant Human PPARG | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPARG-492HCL | Recombinant Human PPARG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pparg Products
Required fields are marked with *
My Review for All Pparg Products
Required fields are marked with *
0
Inquiry Basket