Recombinant Mouse Pgam1 Protein, His-tagged

• Cat.No.: Pgam1-7297M
• Product Overview: Recombinant mouse PGAM1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-254
• Description: Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase), but with a reduced activity.
• Form: Liquid
• Molecular Mass: 31.4 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKVKK
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 0.1 M NaCl, 1 mM DTT

Gene Information

• Gene Name: Pgam1 phosphoglycerate mutase 1 [ Mus musculus (house mouse) ]
• Official Symbol: Pgam1
• Synonyms: Pgam1; phosphoglycerate mutase 1; Pgam; Pgam-1; 2310050F24Rik; phosphoglycerate mutase 1; BPG-dependent PGAM 1; PGAM-B; phosphoglycerate mutase isozyme B; EC 5.4.2.11; EC 5.4.2.4
• Gene ID: 18648
• mRNA Refseq: NM_023418
• Protein Refseq: NP_075907
• UniProt ID: Q9DBJ1