Recombinant Mouse Interferon Beta 1, Fibroblast

• Cat.No.: Ifnb1-37M
• Product Overview: Recombinant Mouse Interferon beta produced inE.Coliis a single, non-glycosylated polypeptide chain containing 162 amino acids and having a molecular mass of 19.8 kDa. Mouse IFN beta is purified by proprietary chromatographic techniques.

Specification

• Cat. No.: Ifnb1-37M
• Description: Interferon-beta 1b has antiviral, antibacterial and anticancer activities. Influenza A viruses not only inhibit IFN-beta gene induction but also supress Type-I IFN signaling via mechanism involving induction of the SOCS-3 protein. Intracellular bacteria and cytosolic poly (dA-dT) trigger IFN-beta responses in different human cells without requiring human ZBP1.
• Source: Escherichia Coli.
• Amino Acid Sequence: MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQN VFLVFRNNFSS TGWNETIVVRLLDELHQQTVFLKTVLE EKQEERLT WEMSSTAL HLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFR NFLIIRRLTRNFQN.
• Purity: Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Formulation: IFN-b Mouse solution containing 10mM sodium phosphate pH-7.5 and 0.5M ammonium sulfate.
• Biological Activity: Determined in a viral cytopathic effect inhibition assay.
• Stability: Store the IFN-beta at 4°C for 4 weeks. Do not freeze/thaw.
• Tag: Non

Gene Information

• Gene Name: Ifnb1 interferon beta 1, fibroblast [ Mus musculus ]
• Synonyms: Ifnb1; interferon beta 1, fibroblast; Ifb; IFNB; IFN-beta; OTTMUSP00000008111; IFB; IFF; IFN-beta; MGC96956; OTTHUMP00000021131; Fibroblast interferon; interferon beta
• Gene ID: 15977
• mRNA Refseq: NM_010510
• Protein Refseq: NP_034640
• UniProt ID: P01575
• Chromosome Location: 4 42.6 cM
• Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity; Toll-like receptor signaling pathway
• Function: cytokine activity; cytokine receptor binding