Recombinant Mouse Interferon Beta 1, Fibroblast

Cat.No. : Ifnb1-37M
Product Overview : Recombinant Mouse Interferon beta produced inE.Coliis a single, non-glycosylated polypeptide chain containing 162 amino acids and having a molecular mass of 19.8 kDa. Mouse IFN beta is purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Description : Interferon-beta 1b has antiviral, antibacterial and anticancer activities. Influenza A viruses not only inhibit IFN-beta gene induction but also supress Type-I IFN signaling via mechanism involving induction of the SOCS-3 protein. Intracellular bacteria and cytosolic poly (dA-dT) trigger IFN-beta responses in different human cells without requiring human ZBP1.
Amino Acid Sequence : MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQN VFLVFRNNFSS TGWNETIVVRLLDELHQQTVFLKTVLE EKQEERLT WEMSSTAL HLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFR NFLIIRRLTRNFQN.
Purity : Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Formulation : IFN-b Mouse solution containing 10mM sodium phosphate pH-7.5 and 0.5M ammonium sulfate.
Biological Activity : Determined in a viral cytopathic effect inhibition assay.
Stability : Store the IFN-beta at 4°C for 4 weeks. Do not freeze/thaw.
Gene Name Ifnb1 interferon beta 1, fibroblast [ Mus musculus ]
Synonyms Ifnb1; interferon beta 1, fibroblast; Ifb; IFNB; IFN-beta; OTTMUSP00000008111; IFB; IFF; IFN-beta; MGC96956; OTTHUMP00000021131; Fibroblast interferon; interferon beta
Gene ID 15977
mRNA Refseq NM_010510
Protein Refseq NP_034640
UniProt ID P01575
Chromosome Location 4 42.6 cM
Pathway Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity; Toll-like receptor signaling pathway
Function cytokine activity; cytokine receptor binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ifnb1 Products

Required fields are marked with *

My Review for All Ifnb1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon