Recombinant Mouse Ifnb1 Protein, His-tagged

• Cat.No.: Ifnb1-7230M
• Product Overview: Recombinant Mouse Interferon beta 1 protein, fused to His-tag, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 22-182
• Description: Has antiviral, antibacterial and anticancer activities.
• Form: Liquid
• Molecular Mass: 22.0 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
  Avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM HEPES (pH 6.0), 0.5M NaCl, 10 % glycerol

Gene Information

• Gene Name: Ifnb1 interferon beta 1, fibroblast [ Mus musculus (house mouse) ]
• Official Symbol: Ifnb1
• Synonyms: Ifnb1; interferon beta 1, fibroblast; If; Ifb; IFNB; IFN-b; If1da1; IFN-beta; interferon beta; interferon 1da1
• Gene ID: 15977
• mRNA Refseq: NM_010510
• Protein Refseq: NP_034640
• UniProt ID: P01575