Recombinant Mouse DOCK8 Protein (561-730 aa), His-tagged

• Cat.No.: DOCK8-2251M
• Product Overview: Recombinant Mouse DOCK8 Protein (561-730 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Description: Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing.
• Source: Yeast
• Species: Mouse
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.2 kDa
• Protein length: 561-730 aa
• AA Sequence: RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Dock8 dedicator of cytokinesis 8 [ Mus musculus (house mouse) ]
• Official Symbol: DOCK8
• Synonyms: Dock8; AI461977; 1200017A24Rik; 5830472H07Rik; A130095G14Rik
• Gene ID: 76088
• mRNA Refseq: NM_028785
• Protein Refseq: NP_083061
• UniProt ID: Q8C147