Recombinant Mouse DOCK8 Protein (561-730 aa), His-tagged
Cat.No. : | DOCK8-2251M |
Product Overview : | Recombinant Mouse DOCK8 Protein (561-730 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 561-730 aa |
Description : | Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.2 kDa |
AA Sequence : | RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Dock8 dedicator of cytokinesis 8 [ Mus musculus (house mouse) ] |
Official Symbol | DOCK8 |
Synonyms | Dock8; AI461977; 1200017A24Rik; 5830472H07Rik; A130095G14Rik; |
Gene ID | 76088 |
mRNA Refseq | NM_028785 |
Protein Refseq | NP_083061 |
UniProt ID | Q8C147 |
◆ Recombinant Proteins | ||
Dock8-2628M | Recombinant Mouse Dock8 Protein, Myc/DDK-tagged | +Inquiry |
DOCK8-2251M | Recombinant Mouse DOCK8 Protein (561-730 aa), His-tagged | +Inquiry |
DOCK8-12H | Recombinant Human DOCK8 protein, MYC/DDK-tagged | +Inquiry |
DOCK8-4758M | Recombinant Mouse DOCK8 Protein | +Inquiry |
DOCK8-2481M | Recombinant Mouse DOCK8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DOCK8 Products
Required fields are marked with *
My Review for All DOCK8 Products
Required fields are marked with *
0
Inquiry Basket