Recombinant Human XRCC5, His-tagged

• Cat.No.: XRCC5-29197TH
• Product Overview: Recombinant fragment, corresponding to amino acids 345-657 of Human Ku80 with an N terminal His tag. Predicted MWt: 37 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 345-657 a.a.
• Description: The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events.This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 98 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHAL DDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYV QLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDS MSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALH PREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFP LIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHF SVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASN QLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQR FNN
• Sequence Similarities: Belongs to the ku80 family.Contains 1 Ku domain.

Gene Information

• Gene Name: XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) [ Homo sapiens ]
• Official Symbol: XRCC5
• Synonyms: XRCC5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining; Ku autoantigen, 80kD); X-ray repair cross
• Gene ID: 7520
• mRNA Refseq: NM_021141
• Protein Refseq: NP_066964
• MIM: 194364
• Uniprot ID: P13010
• Chromosome Location: 2q35
• Pathway: 2-LTR circle formation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; DNA Repair, organism-specific biosystem; DNA-PK complex, organism-specific biosystem
• Function: contributes_to 5-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; double-stranded DNA binding