Recombinant Human XRCC5 protein, His-tagged

• Cat.No.: XRCC5-3773H
• Product Overview: Recombinant Human XRCC5 protein(P13010)(251-455aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.4 kDa
• Protein length: 251-455aa
• AA Sequence: LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) [ Homo sapiens ]
• Official Symbol: XRCC5
• Synonyms: XRCC5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining; Ku autoantigen, 80kD); X-ray repair cross-complementing protein 5; KARP 1; Ku autoantigen; 80kDa; KU80; Ku86; KUB2; TLAA; CTC85; CTCBF; nuclear factor IV; Ku autoantigen, 80kDa; DNA repair protein XRCC5; thyroid-lupus autoantigen; 86 kDa subunit of Ku antigen; lupus Ku autoantigen protein p86; Ku86 autoantigen related protein 1; CTC box-binding factor 85 kDa subunit; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; NFIV; KARP1; KARP-1; FLJ39089
• Gene ID: 7520
• mRNA Refseq: NM_021141
• Protein Refseq: NP_066964
• MIM: 194364
• UniProt ID: P13010