Recombinant Human XRCC5 protein, His-tagged

• Cat.No.: XRCC5-3556H
• Product Overview: Recombinant Human XRCC5 protein(384-732 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 384-732 aa
• AA Sequence: LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) [ Homo sapiens ]
• Official Symbol: XRCC5
• Synonyms: XRCC5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining; Ku autoantigen, 80kD); X-ray repair cross-complementing protein 5; KARP 1; Ku autoantigen; 80kDa; KU80; Ku86; KUB2; TLAA; CTC85; CTCBF; nuclear factor IV; Ku autoantigen, 80kDa; DNA repair protein XRCC5; thyroid-lupus autoantigen; 86 kDa subunit of Ku antigen; lupus Ku autoantigen protein p86; Ku86 autoantigen related protein 1; CTC box-binding factor 85 kDa subunit; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; NFIV; KARP1; KARP-1; FLJ39089
• Gene ID: 7520
• mRNA Refseq: NM_021141
• Protein Refseq: NP_066964
• MIM: 194364
• UniProt ID: P13010