Recombinant Human XPNPEP3 protein, His-tagged
Cat.No. : | XPNPEP3-3510H |
Product Overview : | Recombinant Human XPNPEP3 protein(158-507 aa), fused to His tag, was expressed in E. coli. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 158-507 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | XPNPEP3 X-prolyl aminopeptidase (aminopeptidase P) 3, putative [ Homo sapiens ] |
Official Symbol | XPNPEP3 |
Synonyms | XPNPEP3; X-prolyl aminopeptidase (aminopeptidase P) 3, putative; probable Xaa-Pro aminopeptidase 3; APP3; NPHPL1; X-Pro aminopeptidase 3; |
Gene ID | 63929 |
mRNA Refseq | NM_001204827 |
Protein Refseq | NP_001191756 |
MIM | 613553 |
UniProt ID | Q9NQH7 |
◆ Recombinant Proteins | ||
XPNPEP3-6257H | Recombinant Human XPNPEP3 Protein (Glu253-Gln482), N-His tagged | +Inquiry |
XPNPEP3-1962H | Recombinant Human XPNPEP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
XPNPEP3-414H | Recombinant Human XPNPEP3 Protein, His-tagged | +Inquiry |
XPNPEP3-6274R | Recombinant Rat XPNPEP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
XPNPEP3-6618R | Recombinant Rat XPNPEP3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
XPNPEP3-260HCL | Recombinant Human XPNPEP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XPNPEP3 Products
Required fields are marked with *
My Review for All XPNPEP3 Products
Required fields are marked with *
0
Inquiry Basket