Recombinant Human XPNPEP3 Protein, His-tagged

• Cat.No.: XPNPEP3-414H
• Product Overview: Recombinant Human XPNPEP3, transcript variant 1, fused with His tag at N, C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known.
• Form: Supplied as a 0.2 µM filtered solution of 25mM Tris, 1mM DTT, pH 7.3
• Molecular Mass: 60.2kD
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRG
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: XPNPEP3 X-prolyl aminopeptidase (aminopeptidase P) 3, putative [ Homo sapiens ]
• Official Symbol: XPNPEP3
• Synonyms: XPNPEP3; X-prolyl aminopeptidase (aminopeptidase P) 3, putative; probable Xaa-Pro aminopeptidase 3; APP3; NPHPL1; X-Pro aminopeptidase 3
• Gene ID: 63929
• mRNA Refseq: NM_001204827
• Protein Refseq: NP_001191756
• MIM: 613553
• UniProt ID: Q9NQH7