Recombinant Human XPNPEP3 protein, GST-tagged
| Cat.No. : | XPNPEP3-3752H |
| Product Overview : | Recombinant Human XPNPEP3 protein(158-507 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 158-507 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | PSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | XPNPEP3 X-prolyl aminopeptidase (aminopeptidase P) 3, putative [ Homo sapiens ] |
| Official Symbol | XPNPEP3 |
| Synonyms | XPNPEP3; X-prolyl aminopeptidase (aminopeptidase P) 3, putative; probable Xaa-Pro aminopeptidase 3; APP3; NPHPL1; X-Pro aminopeptidase 3; |
| Gene ID | 63929 |
| mRNA Refseq | NM_001204827 |
| Protein Refseq | NP_001191756 |
| MIM | 613553 |
| UniProt ID | Q9NQH7 |
| ◆ Recombinant Proteins | ||
| XPNPEP3-6618R | Recombinant Rat XPNPEP3 Protein | +Inquiry |
| XPNPEP3-6274R | Recombinant Rat XPNPEP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| XPNPEP3-6257H | Recombinant Human XPNPEP3 Protein (Glu253-Gln482), N-His tagged | +Inquiry |
| XPNPEP3-3510H | Recombinant Human XPNPEP3 protein, His-tagged | +Inquiry |
| XPNPEP3-1962H | Recombinant Human XPNPEP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| XPNPEP3-260HCL | Recombinant Human XPNPEP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XPNPEP3 Products
Required fields are marked with *
My Review for All XPNPEP3 Products
Required fields are marked with *
