Recombinant Human TYMS, His-tagged
Cat.No. : | TYMS-30405TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-191 of Human Thymidylate Synthase with N terminal His tag; MWt 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 97 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHI LRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKR VFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRD FLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYS GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMA |
Protein length : | 1-191 a.a. |
Gene ID | TYMS thymidylate synthetase [ Homo sapiens ] |
Official Symbol | TYMS |
Synonyms | TYMS; thymidylate synthetase; TS; thymidylate synthase; HsT422; TMS; Tsase; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TYMS Products
Required fields are marked with *
My Review for All TYMS Products
Required fields are marked with *
0
Inquiry Basket