Recombinant Human TTR Protein, His-tagged

Cat.No. : TTR-129H
Product Overview : Recombinant Human TTR Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes one of the three prealbumins, which include alpha-1-antitrypsin, transthyretin and orosomucoid. The encoded protein, transthyretin, is a homo-tetrameric carrier protein, which transports thyroid hormones in the plasma and cerebrospinal fluid. It is also involved in the transport of retinol (vitamin A) in the plasma by associating with retinol-binding protein. The protein may also be involved in other intracellular processes including proteolysis, nerve regeneration, autophagy and glucose homeostasis. Mutations in this gene are associated with amyloid deposition, predominantly affecting peripheral nerves or the heart, while a small percentage of the gene mutations are non-amyloidogenic. The mutations are implicated in the etiology of several diseases, including amyloidotic polyneuropathy, euthyroid hyperthyroxinaemia, amyloidotic vitreous opacities, cardiomyopathy, oculoleptomeningeal amyloidosis, meningocerebrovascular amyloidosis and carpal tunnel syndrome.
Form : Liquid. In 140 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4 , pH 8.0.
Molecular Mass : ~16 kDa
AA Sequence : MHHHHHHDDDDKGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIA AMLSPYSYSTTAVVTNPKE*
Purity : >90%
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20-80 centigrade. Avoid freeze/thaw cycles.
Gene Name TTR transthyretin [ Homo sapiens (human) ]
Official Symbol TTR
Synonyms CTS; TTN; ATTR; CTS1; PALB; TBPA; HEL111; HsT2651
Gene ID 7276
mRNA Refseq NM_000371
Protein Refseq NP_000362
MIM 176300
UniProt ID P02766

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TTR Products

Required fields are marked with *

My Review for All TTR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon