Recombinant Cynomolgus TTR Protein, His-tagged
| Cat.No. : | TTR-1059C |
| Product Overview : | Recombinant Cynomolgus TTR protein with a His-tag was expressed in HEK293 |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
| Source : | HEK293 |
| Species : | Cynomolgus |
| Tag : | His |
| Molecular Mass : | The protein has a calculated MW of 14.6 kDa. |
| AA Sequence : | GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKEHHHHHH |
| Endotoxin : | <1 EU/μg |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.32 mg/mL |
| Storage Buffer : | PBS pH7.4 |
| Gene Name | TTR transthyretin [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | TTR |
| Synonyms | TTR; transthyretin; transthyretin (prealbumin, amyloidosis type I); |
| Gene ID | 705943 |
| mRNA Refseq | NM_001261679 |
| Protein Refseq | NP_001248608 |
| UniProt ID | Q8HXW1 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTR Products
Required fields are marked with *
My Review for All TTR Products
Required fields are marked with *
0
Inquiry Basket
