Recombinant Cynomolgus TTR Protein, His-tagged

Cat.No. : TTR-1059C
Product Overview : Recombinant Cynomolgus TTR protein with a His-tag was expressed in HEK293
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Description : Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Molecular Mass : The protein has a calculated MW of 14.6 kDa.
AA Sequence : GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKEHHHHHH
Endotoxin : <1 EU/μg
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.32 mg/mL
Storage Buffer : PBS pH7.4
Gene Name TTR transthyretin [ Macaca mulatta (Rhesus monkey) ]
Official Symbol TTR
Synonyms TTR; transthyretin; transthyretin (prealbumin, amyloidosis type I);
Gene ID 705943
mRNA Refseq NM_001261679
Protein Refseq NP_001248608
UniProt ID Q8HXW1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TTR Products

Required fields are marked with *

My Review for All TTR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon