Recombinant Human TGFA

Description :	This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Source :	E. coli
Tissue specificity :	Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
Form :	Liquid
Storage :	Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids :	Recombinant Human TGF-a is a 5.5 kDa protein containing 50 amino acid residues:VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHA DLLA
Sequence Similarities :	Contains 1 EGF-like domain.
Tag :	Non

Gene Name	TGFA transforming growth factor, alpha [ Homo sapiens ]
Official Symbol	TGFA
Synonyms	TGFA; transforming growth factor, alpha; protransforming growth factor alpha;
Gene ID	7039
mRNA Refseq	NM_001099691
Protein Refseq	NP_001093161
MIM	190170
Uniprot ID	P01135
Chromosome Location	2p13
Pathway	Direct p53 effectors, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem;
Function	MAP kinase kinase activity; epidermal growth factor receptor binding; glycoprotein binding; growth factor activity; protein binding;