Recombinant Human TGFA

Cat.No. : TGFA-29704TH
Product Overview : Human TGF alpha.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Tissue specificity : Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
Form : Liquid
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Recombinant Human TGF-a is a 5.5 kDa protein containing 50 amino acid residues:VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHA DLLA
Sequence Similarities : Contains 1 EGF-like domain.
Gene Name TGFA transforming growth factor, alpha [ Homo sapiens ]
Official Symbol TGFA
Synonyms TGFA; transforming growth factor, alpha; protransforming growth factor alpha;
Gene ID 7039
mRNA Refseq NM_001099691
Protein Refseq NP_001093161
MIM 190170
Uniprot ID P01135
Chromosome Location 2p13
Pathway Direct p53 effectors, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem;
Function MAP kinase kinase activity; epidermal growth factor receptor binding; glycoprotein binding; growth factor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TGFA Products

Required fields are marked with *

My Review for All TGFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon