Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Description : |
This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Form : |
Powder |
Bio-activity : |
Determined by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant human TGF alpha is > 5 x 10^6 IU/mg. |
AA Sequence : |
MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA |
Endotoxin : |
Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : |
> 98% (by SDS-PAGE) |
Applications : |
SDS-PAGE |
Notes : |
For laboratory research only, not for drug, diagnostic or other use. |
Storage : |
Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : |
PBS (pH 8.0) |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |