Recombinant Active Human TGFA Protein, His-tagged(C-ter)

Specification
Gene Information
Related Products
Download

Description :	This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Source :	E. coli
Species :	Human
Tag :	His
Form :	Powder
Bio-activity :	Determined by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant human TGF alpha is > 5 x 10^6 IU/mg.
AA Sequence :	MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Endotoxin :	Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity :	> 98% (by SDS-PAGE)
Applications :	SDS-PAGE
Notes :	For laboratory research only, not for drug, diagnostic or other use.
Storage :	Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer :	PBS (pH 8.0)
Reconstitution :	It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Name	TGFA transforming growth factor, alpha [ Homo sapiens ]
Official Symbol	TGFA
Synonyms	TGFA; transforming growth factor, alpha; protransforming growth factor alpha; TGF-alpha; TFGA;
Gene ID	7039
mRNA Refseq	NM_001099691
Protein Refseq	NP_001093161
MIM	190170
UniProt ID	P01135