Description :	Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis.
Source :	Wheat germ
Species :	Human
Tag :	GST
Molecular Mass :	37.84 kDa
AA Sequence :	FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKA DCSFWSKYISSLKTSADGA KGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK
Applications :	ELISA; WB-Re; AP; Array
Storage :	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	TG thyroglobulin [ Homo sapiens (human) ]
Official Symbol	TG
Synonyms	TG; TGN; AITD3; thyroglobulin
Gene ID	7038
mRNA Refseq	NM_003235
Protein Refseq	NP_003226
MIM	188450
UniProt ID	P01266
Chromosome Location	8q24
Pathway	Autoimmune thyroid disease; Thyroid hormone synthesis
Function	NOT carboxylesterase activity; hormone activity; NOT neurexin family protein binding