Recombinant Human TDGF1 Protein, Fc-tagged

• Cat.No.: TDGF1-562H
• Product Overview: Recombinant human TDGF1 protein with Fc tag was expressed in HEK293.

Specification

• Description: This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Fc
• Form: Lyophilized
• Molecular Mass: 42.6 kDa
• Protein length: 188
• AA Sequence: MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution (reconst).
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens (human) ]
• Official Symbol: TDGF1
• Synonyms: TDGF1; teratocarcinoma-derived growth factor 1; CR; CRIPTO; Cripto 1; cripto-1 growth factor; epidermal growth factor-like cripto protein CR1; CRGF
• Gene ID: 6997
• mRNA Refseq: NM_001174136
• Protein Refseq: NP_001167607
• MIM: 187395
• UniProt ID: P13385