Recombinant Human TBX5

Cat.No. : TBX5-29460TH
Product Overview : Recombinant fragment corresponding to amino acids 402-518 of Human TBX5 with an N terminal proprietary tag; Predicted MWt 38.50 kDa inclusiveof tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 117 amino acids
Description : This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.
Molecular Weight : 38.500kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAG MANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGT LQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
Sequence Similarities : Contains 1 T-box DNA-binding domain.
Gene Name TBX5 T-box 5 [ Homo sapiens ]
Official Symbol TBX5
Synonyms TBX5; T-box 5; HOS; T-box transcription factor TBX5;
Gene ID 6910
mRNA Refseq NM_000192
Protein Refseq NP_000183
MIM 601620
Uniprot ID Q99593
Chromosome Location 12q24.1
Pathway Heart Development, organism-specific biosystem;
Function DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TBX5 Products

Required fields are marked with *

My Review for All TBX5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon