Recombinant Full Length Human TBX5 Protein, C-Flag-tagged
Cat.No. : | TBX5-998HFL |
Product Overview : | Recombinant Full Length Human TBX5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEV GTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPD SPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETA FIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRA LSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEE DSFYRSSYPQQQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDR LPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYS HGVPRTLSPHQYHSVHGVGMVPEWSDNSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | TBX5 T-box transcription factor 5 [ Homo sapiens (human) ] |
Official Symbol | TBX5 |
Synonyms | HOS |
Gene ID | 6910 |
mRNA Refseq | NM_000192.3 |
Protein Refseq | NP_000183.2 |
MIM | 601620 |
UniProt ID | Q99593 |
◆ Recombinant Proteins | ||
TBX5-5635R | Recombinant Rat TBX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
TBX5-5747C | Recombinant Chicken TBX5 | +Inquiry |
TBX5-2164H | Recombinant Human TBX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tbx5-2116M | Recombinant Mouse Tbx5 Protein, His-tagged | +Inquiry |
TBX5-9063M | Recombinant Mouse TBX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBX5-1198HCL | Recombinant Human TBX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBX5 Products
Required fields are marked with *
My Review for All TBX5 Products
Required fields are marked with *
0
Inquiry Basket