Recombinant Human TARDBP protein, His-tagged

• Cat.No.: TARDBP-3014H
• Product Overview: Recombinant Human TARDBP protein(Q13148)(25-181aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 25-181aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.8 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: TVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSK

Gene Information

• Gene Name: TARDBP TAR DNA binding protein [ Homo sapiens ]
• Official Symbol: TARDBP
• Synonyms: TARDBP; TAR DNA binding protein; TAR DNA-binding protein 43; ALS10; TDP 43; TAR DNA-binding protein-43; TDP-43
• Gene ID: 23435
• mRNA Refseq: NM_007375
• Protein Refseq: NP_031401
• MIM: 605078
• UniProt ID: Q13148