Recombinant Human ST3GAL3 Protein (AA 60-375), N-6×His/GFP tagged

• Cat.No.: ST3GAL3-12H
• Product Overview: Recombinant Human ST3GAL3 Protein (AA 60-375) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: GFP&His
• Protein Length: AA 60-375
• Description: The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with a form of autosomal recessive nonsymdromic cognitive disability as well as infantile epileptic encephalopathy. Multiple transcript variants encoding several different isoforms have been found for this gene.
• Molecular Mass: ~60-70 kDa
• AA Sequence: ELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
• Purity: >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens (human) ]
• Official Symbol: ST3GAL3
• Synonyms: ST3GAL3; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; sialyltransferase 6 (N acetyllacosaminide alpha 2,3 sialyltransferase) , SIAT6; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); ST3N; MRT12; SIAT6; ST3GALII; ST3GalIII
• Gene ID: 6487
• mRNA Refseq: NM_001270459
• Protein Refseq: NP_001257388
• MIM: 606494
• UniProt ID: Q11203