Recombinant Human SIX1
Cat.No. : | SIX1-30869TH |
Product Overview : | Recombinant full length Human SIX1 with N-terminal proprietary tag, 56.98 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProteinLength : | 284 amino acids |
Description : | The protein encoded by this gene is a homeobox protein that is similar to the Drosophila sine oculis gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene are a cause of autosomal dominant deafness type 23 (DFNA23) and branchiootic syndrome type 3 (BOS3). |
Molecular Weight : | 56.980kDa inclusive of tags |
Tissue specificity : | Specifically expressed in skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPAC DHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNH PKLQQLWLKAHYVEAEKLCGRPLGAVGKYRVRRKFPLPRT IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEA TGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQ NQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLV DLGS |
Sequence Similarities : | Belongs to the SIX/Sine oculis homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | SIX1 SIX homeobox 1 [ Homo sapiens ] |
Official Symbol | SIX1 |
Synonyms | SIX1; SIX homeobox 1; deafness, autosomal dominant 23 , DFNA23, sine oculis homeobox (Drosophila) homolog 1 , sine oculis homeobox homolog 1 (Drosophila); homeobox protein SIX1; |
Gene ID | 6495 |
mRNA Refseq | NM_005982 |
Protein Refseq | NP_005973 |
MIM | 601205 |
Uniprot ID | Q15475 |
Chromosome Location | 14q23.1 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
TNFRSF17-2070HAF647 | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CRLF2-75H | Recombinant Human CRLF2, MYC/DDK-tagged | +Inquiry |
TBK1-732H | Recombinant Human TANK-binding Kinase 1 | +Inquiry |
TFF1-050T | Active Recombinant Human TFF1 Protein | +Inquiry |
RFL27288CF | Recombinant Full Length Cyanothece Sp. Nad(P)H-Quinone Oxidoreductase Subunit L Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
Lectin-1788G | Active Native Griffonia Simplicifolia Lectin II Protein, Biotinylated | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBA3-604HCL | Recombinant Human UBA3 293 Cell Lysate | +Inquiry |
C1D-8192HCL | Recombinant Human C1D 293 Cell Lysate | +Inquiry |
SIRPG-1002CCL | Recombinant Cynomolgus SIRPG cell lysate | +Inquiry |
KATNB1-5084HCL | Recombinant Human KATNB1 293 Cell Lysate | +Inquiry |
CST8-7226HCL | Recombinant Human CST8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIX1 Products
Required fields are marked with *
My Review for All SIX1 Products
Required fields are marked with *
0
Inquiry Basket