Recombinant Full Length Human SIX1 Protein
Cat.No. : | SIX1-476HF |
Product Overview : | Recombinant full length Human SIX1 with N-terminal proprietary tag, 56.98 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 284 amino acids |
Description : | The protein encoded by this gene is a homeobox protein that is similar to the Drosophila sine oculis gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene are a cause of autosomal dominant deafness type 23 (DFNA23) and branchiootic syndrome type 3 (BOS3). |
Form : | Liquid |
Molecular Mass : | 56.980kDa inclusive of tags |
AA Sequence : | MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPAC DHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNH PKLQQLWLKAHYVEAEKLCGRPLGAVGKYRVRRKFPLPRT IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEA TGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQ NQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLV DLGS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SIX1 SIX homeobox 1 [ Homo sapiens ] |
Official Symbol | SIX1 |
Synonyms | SIX1; SIX homeobox 1; deafness, autosomal dominant 23 , DFNA23, sine oculis homeobox (Drosophila) homolog 1 , sine oculis homeobox homolog 1 (Drosophila); homeobox protein SIX1 |
Gene ID | 6495 |
mRNA Refseq | NM_005982 |
Protein Refseq | NP_005973 |
MIM | 601205 |
UniProt ID | Q15475 |
◆ Recombinant Proteins | ||
NPFFR2-10818M | Recombinant Mouse NPFFR2 Protein | +Inquiry |
APEX1-4792H | Recombinant Human APEX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tnfrsf4-547MF | Recombinant Mouse Tnfrsf4 Protein, FITC conjugated | +Inquiry |
ULBP2-1267H | Active Recombinant Human ULBP2 protein, hFc&His-tagged | +Inquiry |
RFL35031RF | Recombinant Full Length Rat Mitochondrial Carrier Triple Repeat Protein 1(Mcart1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
Lectin-1788G | Active Native Griffonia Simplicifolia Lectin II Protein, Biotinylated | +Inquiry |
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLC1-4935HCL | Recombinant Human KLC1 293 Cell Lysate | +Inquiry |
Jejunum-445S | Sheep Jejunum Lysate, Total Protein | +Inquiry |
PMM2-3087HCL | Recombinant Human PMM2 293 Cell Lysate | +Inquiry |
TNFSF13-1346MCL | Recombinant Mouse TNFSF13 cell lysate | +Inquiry |
MPP5-4230HCL | Recombinant Human MPP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SIX1 Products
Required fields are marked with *
My Review for All SIX1 Products
Required fields are marked with *
0
Inquiry Basket