Recombinant Human SH3BP2 protein, His-tagged

Cat.No. : SH3BP2-4533H
Product Overview : Recombinant Human SH3BP2 protein(401-561 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 401-561 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : VLPRPEKPQLPHLQRSPPDGQSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR
Gene Name SH3BP2 SH3-domain binding protein 2 [ Homo sapiens ]
Official Symbol SH3BP2
Synonyms SH3BP2; SH3-domain binding protein 2; Cherubism; SH3 domain-binding protein 2; CRBM; RES4 23; Abl-SH3 binding protein 2; TNFAIP3 interacting protein 2; 3BP2; CRPM; 3BP-2; RES4-23; FLJ42079; FLJ54978;
Gene ID 6452
mRNA Refseq NM_001122681
Protein Refseq NP_001116153
MIM 602104
UniProt ID P78314

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADAMTS2 Products

Required fields are marked with *

My Review for All ADAMTS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon