Recombinant Human ADAMTS2 Protein, His&Myc-tagged

• Cat.No.: ADAMTS2-1779H
• Product Overview: Recombinant Human ADAMTS2 protein(NP_055059)(254-492aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 254-492aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.2 kDa
• AA Sequence: RRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNEQC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: ADAMTS2 ADAM metallopeptidase with thrombospondin type 1 motif, 2 [ Homo sapiens ]
• Official Symbol: ADAMTS2
• Synonyms: ADAMTS2; ADAM metallopeptidase with thrombospondin type 1 motif, 2; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; A disintegrin and metalloproteinase with thrombospondin motifs 2; ADAM TS2; ADAMTS 3; hPCPNI; NPI; PCINP; procollagen I N proteinase; procollagen N endopeptidase; procollagen I N-proteinase; procollagen N-endopeptidase; procollagen I/II amino propeptide-processing enzyme; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; PNPI; PCPNI; PCI-NP; PC I-NP; ADAM-TS2; ADAMTS-2; ADAMTS-3; DKFZp686F12218
• Gene ID: 9509
• mRNA Refseq: NM_014244
• Protein Refseq: NP_055059
• MIM: 604539
• UniProt ID: O95450