Recombinant Human ADAMTS2 Protein, GST-tagged
Cat.No. : | ADAMTS2-304H |
Product Overview : | Human ADAMTS2 partial ORF ( NP_055059, 1112 a.a. - 1210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature procollagen N-proteinase. This proteinase excises the N-propeptide of the fibrillar procollagens types I-III and type V. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAMTS2 ADAM metallopeptidase with thrombospondin type 1 motif, 2 [ Homo sapiens ] |
Official Symbol | ADAMTS2 |
Synonyms | ADAMTS2; ADAM metallopeptidase with thrombospondin type 1 motif, 2; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; A disintegrin and metalloproteinase with thrombospondin motifs 2; ADAM TS2; ADAMTS 3; hPCPNI; NPI; PCINP; procollagen I N proteinase; procollagen N endopeptidase; procollagen I N-proteinase; procollagen N-endopeptidase; procollagen I/II amino propeptide-processing enzyme; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; PNPI; PCPNI; PCI-NP; PC I-NP; ADAM-TS2; ADAMTS-2; ADAMTS-3; DKFZp686F12218; |
Gene ID | 9509 |
mRNA Refseq | NM_014244 |
Protein Refseq | NP_055059 |
MIM | 604539 |
UniProt ID | O95450 |
◆ Recombinant Proteins | ||
ADAMTS2-1779H | Recombinant Human ADAMTS2 Protein, His&Myc-tagged | +Inquiry |
RBFOX1-3533H | Recombinant Human RBFOX1 protein, His-tagged | +Inquiry |
ADAMTS2-3007C | Recombinant Cattle ADAMTS2, His-tagged | +Inquiry |
ADAMTS2-1778H | Recombinant Human ADAMTS2 protein, His & SUMO-tagged | +Inquiry |
Adamts2-1757M | Recombinant Mouse Adamts2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTS2 Products
Required fields are marked with *
My Review for All ADAMTS2 Products
Required fields are marked with *
0
Inquiry Basket