Recombinant Human RBFOX1 protein, His-tagged

• Cat.No.: RBFOX1-3533H
• Product Overview: Recombinant Human RBFOX1 protein(1-128 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-128 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSE

Gene Information

• Gene Name: RBFOX1 RNA binding protein, fox-1 homolog (C. elegans) 1 [ Homo sapiens ]
• Official Symbol: RBFOX1
• Synonyms: RBFOX1; RNA binding protein, fox-1 homolog (C. elegans) 1; RNA binding protein fox-1 homolog 1; A2BP1; ataxin 2 binding protein 1; FOX 1; hexaribonucleotide binding protein 1; HRNBP1; fox-1 homolog A; ataxin 2-binding protein 1; hexaribonucleotide-binding protein 1; 2BP1; FOX1; FOX-1
• Gene ID: 54715
• mRNA Refseq: NM_001142333
• Protein Refseq: NP_001135805
• MIM: 605104
• UniProt ID: Q9NWB1