Recombinant Human SFN protein(1-248aa), His&Myc-tagged

• Cat.No.: SFN-4644H
• Product Overview: Recombinant Human SFN protein(P31947)(1-248aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His&C-Myc
• Protein length: 1-248aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.8 kDa
• AASequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SFN stratifin [ Homo sapiens ]
• Official Symbol: SFN
• Synonyms: SFN; stratifin; 14-3-3 protein sigma; 14 3 3 sigma; YWHAS; 14-3-3 sigma; epithelial cell marker protein 1
• Gene ID: 2810
• mRNA Refseq: NM_006142
• Protein Refseq: NP_006133
• MIM: 601290
• UniProt ID: P31947