Recombinant Human SFN, His-tagged

• Cat.No.: SFN-26015TH
• Product Overview: Recombinant Full Length Human 14-3-3 sigma expressed in Saccharomyces cerevisiae; amino acids 1-248; 248 amino acids, 27.7 kDa. This protein is tagged with 26 kDa proprietary tag.

Specification

• Species: Human
• Tag: His
• Protein Length: 1-248 a.a.
• Description: 14-3-3 protein sigma is a protein that in humans is encoded by the SFN gene.
• Conjugation: HIS
• Tissue specificity: Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEE RNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKG PEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMD ISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLA KTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
• Sequence Similarities: Belongs to the 14-3-3 family.
• Full Length: Full L.

Gene Information

• Gene Name: SFN stratifin [ Homo sapiens ]
• Official Symbol: SFN
• Synonyms: SFN; stratifin; 14-3-3 protein sigma; 14 3 3 sigma; YWHAS
• Gene ID: 2810
• mRNA Refseq: NM_006142
• Protein Refseq: NP_006133
• MIM: 601290
• Uniprot ID: P31947
• Chromosome Location: 1p36.11
• Pathway: Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem
• Function: phosphoprotein binding; protein binding; protein domain specific binding; protein kinase C inhibitor activity