Recombinant Human SFN Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SFN-4511H
• Product Overview: SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 27.8 kDa
• AA Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SFN stratifin [ Homo sapiens (human) ]
• Official Symbol: SFN
• Synonyms: SFN; stratifin; 14-3-3 protein sigma; 14 3 3 sigma; YWHAS; 14-3-3 sigma; epithelial cell marker protein 1
• Gene ID: 2810
• mRNA Refseq: NM_006142
• Protein Refseq: NP_006133
• MIM: 601290
• UniProt ID: P31947