Recombinant Human SCO2 protein, His-SUMO-tagged

• Cat.No.: SCO2-3473H
• Product Overview: Recombinant Human SCO2 protein(O43819)(43-266aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 43-266aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41.1 kDa
• AA Sequence: PAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) [ Homo sapiens ]
• Official Symbol: SCO2
• Synonyms: SCO2; SCO cytochrome oxidase deficient homolog 2 (yeast); SCO (cytochrome oxidase deficient, yeast) homolog 2; protein SCO2 homolog, mitochondrial; SCO1L; cytochrome oxidase deficient homolog 2; MGC125823; MGC125825
• Gene ID: 9997
• mRNA Refseq: NM_001169109
• Protein Refseq: NP_001162580
• MIM: 604272
• UniProt ID: O43819