Recombinant Human SCO2 protein, His-tagged

• Cat.No.: SCO2-3149H
• Product Overview: Recombinant Human SCO2 protein(NP_001162580)(1-266 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-266 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) [ Homo sapiens ]
• Official Symbol: SCO2
• Synonyms: SCO2; SCO cytochrome oxidase deficient homolog 2 (yeast); SCO (cytochrome oxidase deficient, yeast) homolog 2; protein SCO2 homolog, mitochondrial; SCO1L; cytochrome oxidase deficient homolog 2; MGC125823; MGC125825
• Gene ID: 9997
• mRNA Refseq: NM_001169109
• Protein Refseq: NP_001162580
• MIM: 604272
• UniProt ID: O43819