Recombinant Human RUNX2

Cat.No. : RUNX2-30473TH
Product Overview : Recombinant fragment corresponding to amino acids 251-350 of Human RUNX2 with a proprietary tag at N-terminal; predicted MWT 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Specifically expressed in osteoblasts.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Sequence Similarities : Contains 1 Runt domain.
Tag : Non
Gene Name RUNX2 runt-related transcription factor 2 [ Homo sapiens ]
Official Symbol RUNX2
Synonyms RUNX2; runt-related transcription factor 2; CBFA1, CCD, CCD1; AML3; PEBP2A1; PEBP2aA1;
Gene ID 860
mRNA Refseq NM_001015051
Protein Refseq NP_001015051
MIM 600211
Uniprot ID Q13950
Chromosome Location 6p21
Pathway Androgen Receptor Signaling Pathway, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem;
Function ATP binding; DNA binding; protein binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RUNX2 Products

Required fields are marked with *

My Review for All RUNX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon