Description :	This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing.
Protein length :	100 amino acids
Molecular Weight :	36.630kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Specifically expressed in osteoblasts.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Sequence Similarities :	Contains 1 Runt domain.
Tag :	Non

Gene Name	RUNX2 runt-related transcription factor 2 [ Homo sapiens ]
Official Symbol	RUNX2
Synonyms	RUNX2; runt-related transcription factor 2; CBFA1, CCD, CCD1; AML3; PEBP2A1; PEBP2aA1;
Gene ID	860
mRNA Refseq	NM_001015051
Protein Refseq	NP_001015051
MIM	600211
Uniprot ID	Q13950
Chromosome Location	6p21
Pathway	Androgen Receptor Signaling Pathway, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem;
Function	ATP binding; DNA binding; protein binding; sequence-specific DNA binding transcription factor activity;

COA

Required fields are marked with *

Required fields are marked with *

Overall Rating *

Cat NO.

Review

Your Name

Phone Number

E-mail Address

Cat.No. :	RUNX2-30473TH
Product Overview :	Recombinant fragment corresponding to amino acids 251-350 of Human RUNX2 with a proprietary tag at N-terminal; predicted MWT 36.63kDa inclusive of tag.

Recombinant Human RUNX2