Recombinant Human RUNX2

• Cat.No.: RUNX2-28321TH
• Product Overview: Recombinant fragment corresponding to amino acids 311-450 of Human RUNX2 with a proprietary tag at N-terminal; Predicted MWt 41.03kDa inclusive of tag.

Specification

• Description: This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing.
• Protein length: 140 amino acids
• Molecular Weight: 41.030kDa
• Source: Wheat germ
• Tissue specificity: Specifically expressed in osteoblasts.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS
• Sequence Similarities: Contains 1 Runt domain.
• Tag: Non

Gene Information

• Gene Name: RUNX2 runt-related transcription factor 2 [ Homo sapiens ]
• Official Symbol: RUNX2
• Synonyms: RUNX2; runt-related transcription factor 2; CBFA1, CCD, CCD1; AML3; PEBP2A1; PEBP2aA1
• Gene ID: 860
• mRNA Refseq: NM_001015051
• Protein Refseq: NP_001015051
• MIM: 600211
• Uniprot ID: Q13950
• Chromosome Location: 6p21
• Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem
• Function: ATP binding; DNA binding; protein binding; sequence-specific DNA binding transcription factor activity